PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g19410.4
Common NameLR48_Vigan01g330800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 137aa    MW: 15237.3 Da    PI: 11.3169
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g19410.4genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-163070345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++Tt Ed ++++a+ +lG++ W++Iar ++ gRt++ +k++w+
   Vang01g19410.4 30 PFTTREDAIILHAHDRLGNK-WAAIARLLP-GRTDNAVKNHWN 70
                     89******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.476122IPR017930Myb domain
SuperFamilySSF466892.33E-24277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-10235IPR009057Homeodomain-like
PROSITE profilePS5129421.9562377IPR017930Myb domain
SMARTSM007175.5E-132775IPR001005SANT/Myb domain
PfamPF002491.0E-133070IPR001005SANT/Myb domain
CDDcd001673.38E-103073No hitNo description
Gene3DG3DSA:1.10.10.601.2E-183674IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
LISLHVKGRS GKSCRLRWCN QLSPTVEHRP FTTREDAIIL HAHDRLGNKW AAIARLLPGR  60
TDNAVKNHWN ATLKRRASQR RRFGDDPLTA LTLAPPGSGG GGWTGGFRDV VAREVREYVS  120
FSFSDKLGSN EKLSKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2917832109B-MYB
1gv2_A2e-2917729105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014504223.12e-92PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-35MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0L9TTL04e-97A0A0L9TTL0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RQ434e-97A0A0S3RQ43_PHAAN; Uncharacterized protein
STRINGGLYMA17G36370.22e-65(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-37myb domain protein 70
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]